PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00008.1.g03500.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 594aa    MW: 63923.1 Da    PI: 9.6985
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00008.1.g03500.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP70.33.6e-22278325148
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                                   +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++ g++qrfCqqCsr
  Zjn_sc00008.1.g03500.1.am.mk 278 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVTAGGKQQRFCQQCSR 325
                                   6**********************************************9 PP

2SBP46.11.3e-144164444977
                                   EEETTT--SS--S-STTTT-------S-- CS
                           SBP  49 fhelsefDeekrsCrrrLakhnerrrkkq 77 
                                   fh l+efDe+krsCr+rLa+hn+rrrk++
  Zjn_sc00008.1.g03500.1.am.mk 416 FHVLTEFDEAKRSCRKRLAEHNRRRRKPA 444
                                   ***************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-24271325IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.17276353IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.54E-22277325IPR004333Transcription factor, SBP-box
PfamPF031108.0E-17279325IPR004333Transcription factor, SBP-box
PfamPF031108.2E-8415442IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.15E-10415445IPR004333Transcription factor, SBP-box
PROSITE profilePS5114110.81416443IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MYRTTPLFLS PKQPWRDLLH RRSKACDEAS SSDAEPCHSW TSYMPRVNTN GHTPPKAAAR  60
RGRASSARSL PFSCSGLAPN VSSVHHHTLH WDAASEFSSI TSYIDRSAMI SGRLNAVTSV  120
AGNDFAFAPS MQQPPYLGFD HGVEGGGGSG IGQRAMQNHL YESLDFAAAA AMQFQEAPHH  180
QLLTLPSSLA PMAPPPPLPM PLQMPIPMPG MHGDMYPALG MVKREGGGAE GGRIGLNLGR  240
RTYFSPGDML AVDRLLMRSR LGGVFGLGFG GAHHQPPRCQ AEGCKADLSG AKHYHRRHKV  300
CEYHAKASVV TAGGKQQRFC QQCSRSVTSQ LARSFSLSSL VGSRGAMLLV RVPYLLRALR  360
PWPKAAASPL DARGDLAVPP EFGSPVVQPP LAAAIWGPDC PNLLACFTLI PALTGFHVLT  420
EFDEAKRSCR KRLAEHNRRR RKPAAAADGG TSSAAKKLNS GAITSSYTTD NKNLTSTTKS  480
TMSSNPSSVI SYLDQGKQAR PTLTLGASQD KDQQQQLSTM LQVQSSGHRH QDQQHFISSL  540
QVHHQSSNNN NMLSCSSACS SALPSANGEL SDQTNNSNTG NGNNSVHLFE VDFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A1e-16279325652squamosa promoter-binding protein-like 12
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1425442KRSCRKRLAEHNRRRRKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965676.11e-81PREDICTED: squamosa promoter-binding-like protein 10
SwissprotA2YFT97e-61SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE87e-61SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
STRINGSi006559m3e-81(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.21e-26squamosa promoter binding protein-like 8